PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_08462
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 25272.9 Da    PI: 9.2586
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_08462genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.32.7e-301463150
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                k+ien +nrqvtf+kRrng+lKKA+EL vLCdaevaviifss+g+lyey+
  PEQU_08462 14 KKIENATNRQVTFCKRRNGLLKKAYELAVLCDAEVAVIIFSSRGRLYEYA 63
                68***********************************************8 PP

2K-box102.17.2e-3482175497
       K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                 s++ s++++++e++q+e++kL ++i  Lq+++R+l+Ge L++++l+eL+qLe +Lek+++kiRs+Knell+++ie++ kke elq++n++Lr+k
  PEQU_08462  82 SNTGSTNQTNSEYYQHEASKLLQQITDLQTSNRNLMGEALSTMNLRELKQLEARLEKAINKIRSRKNELLYAEIEYMHKKEMELQNDNMYLRNK 175
                 4444489999**********************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.282666IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-39665IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-32789IPR002100Transcription factor, MADS-box
CDDcd002653.11E-43778No hitNo description
PRINTSPR004042.2E-31828IPR002100Transcription factor, MADS-box
PROSITE patternPS003500862IPR002100Transcription factor, MADS-box
PfamPF003192.2E-261562IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-312843IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-314364IPR002100Transcription factor, MADS-box
PfamPF014862.0E-2687175IPR002487Transcription factor, K-box
PROSITE profilePS5129714.68892182IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MERNTKGRGK IDIKKIENAT NRQVTFCKRR NGLLKKAYEL AVLCDAEVAV IIFSSRGRLY  60
EYANNSVKGT IERYKKASTD NSNTGSTNQT NSEYYQHEAS KLLQQITDLQ TSNRNLMGEA  120
LSTMNLRELK QLEARLEKAI NKIRSRKNEL LYAEIEYMHK KEMELQNDNM YLRNKEPIQR  180
IVDCVTNLDS IVYSLKECSP SIVLVIDYRL VEVPSGVFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19788283Myocyte-specific enhancer factor 2B
1tqe_Q2e-19788283Myocyte-specific enhancer factor 2B
1tqe_R2e-19788283Myocyte-specific enhancer factor 2B
1tqe_S2e-19788283Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008791901.11e-95PREDICTED: MADS-box transcription factor 3 isoform X1
RefseqXP_008791911.12e-95PREDICTED: MADS-box transcription factor 3 isoform X2
SwissprotQ407042e-88MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLQ2IA041e-101Q2IA04_DENCR; AGAMOUS-like transcription factor
TrEMBLX2FB301e-101X2FB30_9ASPA; MADS-box protein 20
STRINGGSMUA_Achr10P14160_0019e-89(Musa acuminata)
STRINGGSMUA_Achr10P21480_0012e-88(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.15e-83MIKC_MADS family protein